Structure of PDB 7sdp Chain C Binding Site BS04

Receptor Information

>7sdp Chain C (length=225) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDEHDGICEIHV
AKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRKGYESFPWFIKPAHSP
SRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQY
RKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM
RLSYIEKKKGRQTTHIVFSFRDITS

Ligand information

>7sdp Chain D (length=4) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GGGG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7sdp Towards automated crystallographic structure refinement with phenix.refine.
Resolution	3.01 Å
Binding residue (original residue number in PDB)	K11 R12 R17 T246
Binding residue (residue number reindexed from 1)	K1 R2 R7 T224

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7sdp, PDBe:7sdp, PDBj:7sdp
PDBsum	7sdp
PubMed	37407546
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]