Structure of PDB 5kx5 Chain C Binding Site BS04

Receptor Information

>5kx5 Chain C (length=440) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN
TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA
NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT
SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV

Ligand information

Ligand ID

InChI

InChI=1S/Ca/q+2

InChIKey

BHPQYMZQTOCNFJ-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Ca++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Ca+2]

Formula

Name

CALCIUM ION

PDB chain

5kx5 Chain C Residue 503 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5kx5 Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	D39 T41 G44 G45 E55
Binding residue (residue number reindexed from 1)	D39 T41 G44 G45 E55
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005200	structural constituent of cytoskeleton
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0000278	mitotic cell cycle
GO:0001764	neuron migration
GO:0001964	startle response
GO:0006886	intracellular protein transport
GO:0007017	microtubule-based process
GO:0007098	centrosome cycle
GO:0007224	smoothened signaling pathway
GO:0007613	memory
GO:0007626	locomotory behavior
GO:0008344	adult locomotory behavior
GO:0008542	visual learning
GO:0009612	response to mechanical stimulus
GO:0010001	glial cell differentiation
GO:0010467	gene expression
GO:0021542	dentate gyrus development
GO:0021696	cerebellar cortex morphogenesis
GO:0021766	hippocampus development
GO:0021859	pyramidal neuron differentiation
GO:0021987	cerebral cortex development
GO:0022008	neurogenesis
GO:0030182	neuron differentiation
GO:0030317	flagellated sperm motility
GO:0030534	adult behavior
GO:0034612	response to tumor necrosis factor
GO:0035641	locomotory exploration behavior
GO:0046785	microtubule polymerization
GO:0048853	forebrain morphogenesis
GO:0048873	homeostasis of number of cells within a tissue
GO:0050807	regulation of synapse organization
GO:0050808	synapse organization
GO:0051402	neuron apoptotic process
GO:0061744	motor behavior
GO:0071277	cellular response to calcium ion
GO:0072384	organelle transport along microtubule
GO:0140058	neuron projection arborization
GO:1902065	response to L-glutamate

	Cellular Component
GO:0000793	condensed chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005879	axonemal microtubule
GO:0005881	cytoplasmic microtubule
GO:0005886	plasma membrane
GO:0015630	microtubule cytoskeleton
GO:0031594	neuromuscular junction
GO:0036126	sperm flagellum
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0045202	synapse
GO:0055037	recycling endosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5kx5, PDBe:5kx5, PDBj:5kx5
PDBsum	5kx5
PubMed	27882198
UniProt	D0VWZ0

[Back to BioLiP]