Structure of PDB 8ove Chain Bh Binding Site BS04

Receptor Information
>8ove Chain Bh (length=147) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAEARKSRDDRRWKRVLAKMDKYHGVGNTRVRGCTRASLFKRTGRKPDNI
VMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTF
IWHKGVKGVPGRVRVRVERKSETRKHFYTVISHIPVPSFKNLTTKVI
Ligand information
>8ove Chain BH (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugucccucuccaaacgagaguacaugcaugggcuggcaugagcggcacgc
uccauggggcucgaggggcaccgucccgaggcgcugaaccuugaugcuug
gaaucaugcucagggacu
.<<<<<.<<<.......>>>.....<<<<<<<<.<<.....<<<....<.
<<<...>>>.>....<<<......>>>....>>>....>>.....>>>..
....>>>>>...>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H54 G55 R64 R66 T69 R70 A71 F74 R76 T77 K80 H91 K94 K97 K118 R146 K179 N180 L181
Binding residue
(residue number reindexed from 1)		H24 G25 R30 R32 T35 R36 A37 F40 R42 T43 K46 H57 K60 K63 K84 R112 K140 N141 L142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38DH8

[Back to BioLiP]