Structure of PDB 8ova Chain BR Binding Site BS04

Receptor Information

>8ova Chain BR (length=151) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HYSRKPQVSSKTAKAKIADLRCHYKNTFETANVINGMKLRKAQQLYRQVL
AKTRCIPFKRYNGKIGNTAQAKEWGQTKGRWPRKSVVAMLSLLKNAEANA
IEKGLDPGKMVIKHVQVDQAPRVRRRTFRAHGRITPYMRSPCHVQLFMTQ
P

Ligand information

>8ova Chain BC (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaauugcccaaucuuugaacgc
aaacggcgcaugggagaagcucgagccauccccgugcaugccacauuucu
cagugucgaa

.........................................<<<<<<<<<
....>>>>.....(<<<<......>>......>>>>.)...>>>....<<
.....>><<<<<<<....<<<..>>>....>>>>>>>.............
..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.47 Å
Binding residue (original residue number in PDB)	H3 S5 D120 Q121
Binding residue (residue number reindexed from 1)	H1 S3 D118 Q119

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q385T6

[Back to BioLiP]