Structure of PDB 7svw Chain B Binding Site BS04

Receptor Information
>7svw Chain B (length=446) Species: 1469607 ([Scytonema hofmanni] UTEX 2349) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEKNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRT
VQRLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKR
MTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGW
RGTTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTT
VIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTY
GKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLN
DQLFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSID
ARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQN
LMYRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7svw Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.
Resolution3.69 Å
Binding residue
(original residue number in PDB)
R58 V74 S75 R77 R99 D101 K132 Y153
Binding residue
(residue number reindexed from 1)
R30 V46 S47 R49 R71 D73 K104 Y125
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 13:29:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7svw', asym_id = 'B', bs = 'BS04', title = 'Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7svw', asym_id='B', bs='BS04', title='Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0015074', uniprot = '', pdbid = '7svw', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0015074', uniprot='', pdbid='7svw', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>