Structure of PDB 7lbw Chain B Binding Site BS04

Receptor Information
>7lbw Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lbw A minimal motif for sequence recognition by mitochondrial transcription factor A (TFAM).
Resolution2.84 Å
Binding residue
(original residue number in PDB)
S55 S56 Y57 T78 I81 A85 W88 Y103 R140 M143 T144
Binding residue
(residue number reindexed from 1)
S12 S13 Y14 T35 I38 A42 W45 Y60 R97 M100 T101
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lbw, PDBe:7lbw, PDBj:7lbw
PDBsum7lbw
PubMed34928349
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]