Structure of PDB 7ccd Chain B Binding Site BS04

Receptor Information
>7ccd Chain B (length=164) Species: 38300 (Streptomyces pristinaespiralis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTDTDRSEDFLRRVRGLKAARTANGPRLYQPITLLWAVGRARRGEARTL
AWADTDEAIGALLKRHGARGERPRPDYPVLALHRAGLWTLEGHVGEVPTA
HGDSALRNWFAEQRPVGGLAEPFHDLLHRSGHSRVSVIEALLTTYFAGLD
PVPLLEDTGLYDEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ccd DNA backbone interactions impact the sequence specificity of DNA sulfur-binding domains: revelations from structural analyses.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		K20 A22 R29 Y31 Q32 R73 Y78 P79 R85 T100 A101 H102 G103 D104
Binding residue
(residue number reindexed from 1)		K19 A21 R28 Y30 Q31 R72 Y77 P78 R84 T99 A100 H101 G102 D103
Enzymatic activity
Enzyme Commision number ?
External links