Structure of PDB 5a39 Chain B Binding Site BS04

Receptor Information
>5a39 Chain B (length=115) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYF
LTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGL
DEEWQRREEGKAHRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a39 Structural Insights Into the Recognition of Cisplatin and Aaf-Dg Lesion by Rad14 (Xpa).
Resolution2.8 Å
Binding residue
(original residue number in PDB)
P153 F174 R206
Binding residue
(residue number reindexed from 1)
P54 F75 R107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
Biological Process
GO:0006289 nucleotide-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5a39, PDBe:5a39, PDBj:5a39
PDBsum5a39
PubMed26100901
UniProtP28519|RAD14_YEAST DNA repair protein RAD14 (Gene Name=RAD14)

[Back to BioLiP]