Structure of PDB 4mte Chain B Binding Site BS04

Receptor Information

>4mte Chain B (length=150) Species: 83333 (Escherichia coli K-12)

KTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLR
EAEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFI
CDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEAC

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4mte Chain B Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4mte Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): C103 C106 C143 C146
• Binding residue (residue number reindexed from 1): C101 C104 C141 C144
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0042802 identical protein binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900376 regulation of secondary metabolite biosynthetic process

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:4mte, PDBe:4mte, PDBj:4mte
• PDBsum: 4mte
• PubMed: 25369000
• UniProt: P0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)