Structure of PDB 2vjv Chain B Binding Site BS04

Receptor Information

>2vjv Chain B (length=125) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEI
IEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPT
LWTNSCFISTVGGAPLNVVKQYIEN

Ligand information

>2vjv Chain F (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tattac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2vjv Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y27 R28 H64
Binding residue (residue number reindexed from 1)	Y22 R23 H59

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2vjv, PDBe:2vjv, PDBj:2vjv
PDBsum	2vjv
PubMed	18243097
UniProt	Q933Z0

[Back to BioLiP]