--> -->

Structure of PDB 4v9q Chain A4 Binding Site BS04

Receptor Information
>4v9q Chain A4 (length=48) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK
Traceback (most recent call last):
  File "/var/www/html/BioLiP/pdb.cgi", line 1465, in <module>
    pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
  File "/var/www/html/BioLiP/pdb.cgi", line 903, in display_interaction
    with open('./pdb_cgi_debug.log', 'a') as f:
PermissionError: [Errno 13] Permission denied: './pdb_cgi_debug.log'