Structure of PDB 8djh Chain A Binding Site BS04

Receptor Information
>8djh Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPM
NSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain8djh Chain A Residue 103 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8djh Zinc controls PML nuclear body formation through regulation of a paralog specific auto-inhibition in SUMO1.
Resolution1.77 Å
Binding residue
(original residue number in PDB)		E33 H35
Binding residue
(residue number reindexed from 1)		E24 H26
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008134 transcription factor binding
GO:0015459 potassium channel regulator activity
GO:0019899 enzyme binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044388 small protein activating enzyme binding
GO:0044389 ubiquitin-like protein ligase binding
GO:1990381 ubiquitin-specific protease binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription
GO:0010621 negative regulation of transcription by transcription factor localization
GO:0016925 protein sumoylation
GO:0030578 PML body organization
GO:0031334 positive regulation of protein-containing complex assembly
GO:0031647 regulation of protein stability
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032880 regulation of protein localization
GO:0034605 cellular response to heat
GO:0042308 negative regulation of protein import into nucleus
GO:0043392 negative regulation of DNA binding
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045759 negative regulation of action potential
GO:0045892 negative regulation of DNA-templated transcription
GO:0050821 protein stabilization
GO:0060021 roof of mouth development
GO:0071276 cellular response to cadmium ion
GO:0086004 regulation of cardiac muscle cell contraction
GO:0090204 protein localization to nuclear pore
GO:1901896 positive regulation of ATPase-coupled calcium transmembrane transporter activity
GO:1902260 negative regulation of delayed rectifier potassium channel activity
GO:1903169 regulation of calcium ion transmembrane transport
Cellular Component
GO:0001741 XY body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0016604 nuclear body
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031965 nuclear membrane
GO:0097165 nuclear stress granule
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8djh, PDBe:8djh, PDBj:8djh
PDBsum8djh
PubMed35871297
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]