Structure of PDB 7tfk Chain A Binding Site BS04

Receptor Information
>7tfk Chain A (length=360) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REEDKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKD
GSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNANGKHFVIIMDEV
DGMGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANS
IKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTIN
HENINEISKAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYF
DDFDFTPLMIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIR
SSEQLWSLLPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRL
LQEIHYHTRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tfk Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		G315 H556 G662 R663 I664
Binding residue
(residue number reindexed from 1)		G24 H224 G330 R331 I332
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005663 DNA replication factor C complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tfk, PDBe:7tfk, PDBj:7tfk
PDBsum7tfk
PubMed35829698
UniProtP38630|RFC1_YEAST Replication factor C subunit 1 (Gene Name=RFC1)

[Back to BioLiP]