Structure of PDB 6r1q Chain A Binding Site BS04

Receptor Information

>6r1q Chain A (length=148) Species: 10090 (Mus musculus)

RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDG

Ligand information

• Ligand ID: AR
• InChI: InChI=1S/Ar
• InChIKey: XKRFYHLGVUSROY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Ar]
• Formula: Ar
• Name: ARGON
• PDB chain: 6r1q Chain A Residue 206

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6r1q Gas-sensitive biological crystals processed in pressurized oxygen and krypton atmospheres: deciphering gas channels in proteins using a novel `soak-and-freeze' methodology
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): G24 F28 V68 M69
• Binding residue (residue number reindexed from 1): G22 F26 V66 M67
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.7.-.-

Gene Ontology

Molecular Function

• GO:0005092 GDP-dissociation inhibitor activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0071456 cellular response to hypoxia

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol

External links

• PDB: RCSB:6r1q, PDBe:6r1q, PDBj:6r1q
• PDBsum: 6r1q
• UniProt: Q9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)