Structure of PDB 5mhk Chain A Binding Site BS04

Receptor Information
>5mhk Chain A (length=186) Species: 10298 (Human alphaherpesvirus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAFYARYRDGYVSGEPWPGAGPPPPGRVLYGGLGDSRPGLWGAPEAEEAR
RRFEASGAPAAVWAPELGDAAQQYALITRLLYTPDAEAMGWLQNPRVVPG
DVALDQACFRISGAARNSSSFITGSVARAVPHLGYAMAAGRFGWGLAHAA
AAVAMSRRYDRAQKGFLLTSLRRAYAPLLARENAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mhk The herpes viral transcription factor ICP4 forms a novel DNA recognition complex.
Resolution2.28 Å
Binding residue
(original residue number in PDB)		S418 R456 R457
Binding residue
(residue number reindexed from 1)		S119 R157 R158
Binding affinityPDBbind-CN: Kd=1.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045893 positive regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5mhk, PDBe:5mhk, PDBj:5mhk
PDBsum5mhk
PubMed28505309
UniProtP08392|ICP4_HHV11 Major viral transcription factor ICP4 (Gene Name=ICP4)

[Back to BioLiP]