Structure of PDB 5akn Chain A Binding Site BS04

Receptor Information
>5akn Chain A (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAPL
MQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMRE
QIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDD
HRHGVYVLNISLRDRIKFVHTILSSHLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5akn Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		A116 D119 M120 R124 R126 W128
Binding residue
(residue number reindexed from 1)		A111 D114 M115 R119 R121 W123
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5akn, PDBe:5akn, PDBj:5akn
PDBsum5akn
PubMed26045557
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]