Structure of PDB 5akf Chain A Binding Site BS04

Receptor Information
>5akf Chain A (length=179) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5akf Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		R104 H181 L182
Binding residue
(residue number reindexed from 1)		R100 H177 L178
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5akf, PDBe:5akf, PDBj:5akf
PDBsum5akf
PubMed26045557
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]