Structure of PDB 4auv Chain A Binding Site BS04

Receptor Information
>4auv Chain A (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEDYERRRSECVSEMLDLEKQFSELKEKLFRERLS
Ligand information
>4auv Chain H (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SECVSEMLDLEKQFSELKEKLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4auv Brms151-98 and Brms151-84 are Crystal Oligomeric Coiled Coils with Different Oligomerization States, which Behave as Disordered Protein Fragments in Solution.
Resolution1.999 Å
Binding residue
(original residue number in PDB)		S50 Y53
Binding residue
(residue number reindexed from 1)		S1 Y4
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4auv, PDBe:4auv, PDBj:4auv
PDBsum4auv
PubMed23500495
UniProtQ9HCU9|BRMS1_HUMAN Breast cancer metastasis-suppressor 1 (Gene Name=BRMS1)

[Back to BioLiP]