Structure of PDB 3s9c Chain A Binding Site BS04

Receptor Information

>3s9c Chain A (length=234) Species: 343250 (Daboia siamensis)

VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIR
IKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTY
STHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWC
EPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEP
CGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3s9c Chain A Residue 501

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3s9c Structural basis of coagulation factor V recognition for cleavage by RVV-V
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): H192 E218
• Binding residue (residue number reindexed from 1): H177 E199
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 H192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D88 H177 G178 D179 S180 G181
• Enzyme Commision number: 3.4.21.95: snake venom factor V activator.

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0008236 serine-type peptidase activity
• GO:0090729 toxin activity

Biological Process

• GO:0006508 proteolysis
• GO:0035821 modulation of process of another organism

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:3s9c, PDBe:3s9c, PDBj:3s9c
• PDBsum: 3s9c
• PubMed: 21871889
• UniProt: P18965|VSPG_DABSI Factor V activator RVV-V gamma