Structure of PDB 3knt Chain A Binding Site BS04

Receptor Information
>3knt Chain A (length=207) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMLIKKIEELKNSEIKDIIDKRIQEFKSFKNKSNEEWFKELCFCILTANF
TAEGGIRIQKEIGDGFLTLPREELEEKLKNLGHRFYRKRAEYIVLARRFK
NIKDIVESFENEKVAREFLVRNIKGIGYQEASHFLRNVGYDDVAIIDRHI
LRELYENNYIDEIPKTLSRRKYLEIENILRDIGEEVNLKLSELDLYIWYL
RTGKVLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3knt The C-terminal Lysine of Ogg2 DNA Glycosylases is a Major Molecular Determinant for Guanine/8-Oxoguanine Distinction.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		N177 I178 D181
Binding residue
(residue number reindexed from 1)		N177 I178 D181
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3knt, PDBe:3knt, PDBj:3knt
PDBsum3knt
PubMed20083120
UniProtQ58134|OGG1_METJA 8-oxoguanine DNA glycosylase/AP lyase (Gene Name=ogg)

[Back to BioLiP]