Structure of PDB 2qnc Chain A Binding Site BS04

Receptor Information
>2qnc Chain A (length=157) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKA
GKVRGLLCNLCDAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYT
QNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKK
QLRKSLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qnc Crystal structure of T4 endonuclease VII resolving a Holliday junction.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K121 T140 K141
Binding residue
(residue number reindexed from 1)		K121 T140 K141
Enzymatic activity
Catalytic site (original residue number in PDB) D40 D62
Catalytic site (residue number reindexed from 1) D40 D62
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:2qnc, PDBe:2qnc, PDBj:2qnc
PDBsum2qnc
PubMed17873859
UniProtP13340|END7_BPT4 Recombination endonuclease VII (Gene Name=49)

[Back to BioLiP]