Structure of PDB 1jao Chain A Binding Site BS04

Receptor Information

>1jao Chain A (length=158) Species: 9606 (Homo sapiens)

NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQG
EADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTN
TSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDI
DGIQAIYG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1jao Chain A Residue 998

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1jao X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): H147 D149 H162 H175
• Binding residue (residue number reindexed from 1): H63 D65 H78 H91
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): H197 E198 H201 H207
• Catalytic site (residue number reindexed from 1): H113 E114 H117 H123
• Enzyme Commision number: 3.4.24.34: neutrophil collagenase.

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:1jao, PDBe:1jao, PDBj:1jao
• PDBsum: 1jao
• PubMed: 7737183
• UniProt: P22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)