Structure of PDB 7jt2 Chain 8 Binding Site BS04

Receptor Information
>7jt2 Chain 8 (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEY
YKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTE
KKARRPTRPTRASKERRLASKAQKSSVKAMRG
Ligand information
>7jt2 Chain 4 (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggagguaaaaauguaaaaaa
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jt2 ArfB can displace mRNA to rescue stalled ribosomes
Resolution3.5 Å
Binding residue
(original residue number in PDB)		P107 R109 T111 R112
Binding residue
(residue number reindexed from 1)		P106 R108 T110 R111
Enzymatic activity
Enzyme Commision number 3.1.1.29: peptidyl-tRNA hydrolase.
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0016787 hydrolase activity
GO:0043022 ribosome binding
Biological Process
GO:0006415 translational termination
GO:0006417 regulation of translation
GO:0072344 rescue of stalled ribosome
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jt2, PDBe:7jt2, PDBj:7jt2
PDBsum7jt2
PubMed33144582
UniProtP40711|ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB (Gene Name=arfB)

[Back to BioLiP]