Structure of PDB 6og7 Chain 8 Binding Site BS04

Receptor Information

>6og7 Chain 8 (length=361) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

INPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERA
QALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAEL
DALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYL
RWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVR
KSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQH
VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKK
NAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSL
DQFIEASLKAG

Ligand information

>6og7 Chain 4 (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggagguaaaaaugugaaaa

....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6og7 Extensive ribosome and RF2 rearrangements during translation termination.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	G137 G138 T139 E140 S205 R212 R213 H214 T215
Binding residue (residue number reindexed from 1)	G134 G135 T136 E137 S202 R209 R210 H211 T212

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003747	translation release factor activity
GO:0016149	translation release factor activity, codon specific

	Biological Process
GO:0006412	translation
GO:0006415	translational termination
GO:0075523	viral translational frameshifting

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6og7, PDBe:6og7, PDBj:6og7
PDBsum	6og7
PubMed	31513010
UniProt	P07012\|RF2_ECOLI Peptide chain release factor RF2 (Gene Name=prfB)

[Back to BioLiP]