Structure of PDB 8ugp Chain 1I Binding Site BS04

Receptor Information
>8ugp Chain 1I (length=126) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATINYPEKGPLSPRFRGEHALRRYPGEERCIACKLCEAVCPAQAITIEAE
PRSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN
KEKLLNNGDKWEAEIAANIQADYLYR
Ligand information
>8ugp Chain 1R (length=26) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
THTGQRQKEVNENFADGGGGALGHPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R69 Y70 E74 E75 R76 P127 K151 E152 K153 N156 D159 Y173
Binding residue
(residue number reindexed from 1)		R23 Y24 E27 E28 R29 P77 K101 E102 K103 N106 D109 Y123
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum8ugp
PubMed38811722
UniProtA0A286ZUN9

[Back to BioLiP]