Structure of PDB 8fzh Chain w Binding Site BS03

Receptor Information

>8fzh Chain w (length=349) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPSIVAKLEALHERHEEVQALLGDAQTIADQERFRALSREYAQLSDVSRC
FTDWQQVQEDIETAQMMLDDPEMREMAQDELREAKEKSEQLEQQLQVDDE
RNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSASEGEHGG
YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPE
LPDAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQ
DERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGSGDRSDRNR
TYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQADQLAALS

Ligand information

>8fzh Chain z (length=11) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaauucuaaua

...........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8fzh The ribosome termination complex remodels release factor RF3 and ejects GDP.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	G120 T190 R195 I196 H197 T198
Binding residue (residue number reindexed from 1)	G112 T182 R187 I188 H189 T190

Gene Ontology

	Molecular Function
GO:0016149	translation release factor activity, codon specific

	Biological Process
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fzh, PDBe:8fzh, PDBj:8fzh
PDBsum	8fzh
PubMed	39030416
UniProt	C3TCZ2

[Back to BioLiP]