Structure of PDB 7pi9 Chain u Binding Site BS03

Receptor Information
>7pi9 Chain u (length=86) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVYPGVNVG
LGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKL
Ligand information
>7pi9 Chain 7 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucuuguagcucagucgguagagcaacggucugaagaaccgugugucgg
caguucgauucugcccgagaccacca
<<<<<<...<<<<........>>>>..<<<<.......>>>>......<<
<<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pi9 Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		K19 G20
Binding residue
(residue number reindexed from 1)		K3 G4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pi9, PDBe:7pi9, PDBj:7pi9
PDBsum7pi9
PubMed36171285
UniProtP75458|RL27_MYCPN Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]