Structure of PDB 6zym Chain u Binding Site BS03

Receptor Information
>6zym Chain u (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIY
KGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTME
HGATRNFQLNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEA
MLRQHRL
Ligand information
>6zym Chain Y (length=41) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaaaugaugucauacuuauccug
.........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zym Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
R4 R34 K60
Binding residue
(residue number reindexed from 1)
R3 R33 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome

View graph for
Biological Process
External links
PDB RCSB:6zym, PDBe:6zym, PDBj:6zym
PDBsum6zym
PubMed33007253
UniProtQ9BW85|YJU2_HUMAN Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]