Structure of PDB 8etg Chain t Binding Site BS03

Receptor Information
>8etg Chain t (length=235) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVLLKKRKVNERTRKERVEQAIAKKEAQKKNRKETFKRAETFINNYRQR
ERERIRLNRSAKNKGDIFVPDETKLLFVIRIAGVKNMPPKIRKVLRLLRL
SRINNAVFVRNNKAVAQMLRIVEPYVMYGIPNLHSVRELIYKRGFGKING
QRIALSDNALIEEALGKYDVISIEDIIHEIYNVGSHFKEVTKFLWPFTLT
PVKHSLMEKKVKHFNEGRKAGYCGEEINELIKKQV
Ligand information
>8etg Chain 6 (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacaugagguguugaacgaaaauauuuaguuugaaaucgg
ugaaauuuuacc
........<<<<..>>>>.....<<<<...<<..>>..>>>>........
.<<<..>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etg Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		E55 N59 Y61 Q63 R68 I69 R73 E137 K226 H227
Binding residue
(residue number reindexed from 1)		E41 N45 Y47 Q49 R54 I55 R59 E123 K212 H213
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etg, PDBe:8etg, PDBj:8etg
PDBsum8etg
PubMed36423630
UniProtP17937|RL7A_SCHPO Large ribosomal subunit protein uL30A (Gene Name=rlp7)

[Back to BioLiP]