Structure of PDB 7uoo Chain t Binding Site BS03

Receptor Information
>7uoo Chain t (length=287) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAK
TLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREKTTY
DGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYP
LLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIV
EEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNR
LRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
Ligand information
>7uoo Chain 6 (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauguuugguagugagugauacucgaguuaacuugaaauu
gccuuaaa
......<<<<<..>>>>>.....<<<<.<.<<<..>>>>.>>>>......
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uoo rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		R49 E59 A63 L66 R70 R77 H92 I93 A94 S95 K97 K132 R146 R148 G149 V153 I155 E170 T171 R275 S278 F280 R292 N303 A304
Binding residue
(residue number reindexed from 1)		R35 E45 A49 L52 R56 R63 H78 I79 A80 S81 K83 K97 R111 R113 G114 V118 I120 E135 T136 R240 S243 F245 R257 N268 A269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uoo, PDBe:7uoo, PDBj:7uoo
PDBsum7uoo
PubMed36864048
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]