Structure of PDB 6ylx Chain t Binding Site BS03

Receptor Information
>6ylx Chain t (length=287) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAK
TLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREKTTY
DGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYP
LLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIV
EEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNR
LRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
Ligand information
>6ylx Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ylx Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		K46 R49 E59 S60 L66 R70 R77 Q91 H92 I93 A94 S95 K97 R146 R148 G149 L151 V153 I155 E170 R275 F280 K288 R292 S302 N303 A304
Binding residue
(residue number reindexed from 1)		K32 R35 E45 S46 L52 R56 R63 Q77 H78 I79 A80 S81 K83 R111 R113 G114 L116 V118 I120 E135 R240 F245 K253 R257 S267 N268 A269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ylx, PDBe:6ylx, PDBj:6ylx
PDBsum6ylx
PubMed32668200
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]