Structure of PDB 6m62 Chain t Binding Site BS03

Receptor Information
>6m62 Chain t (length=287) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAK
TLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREKTTY
DGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYP
LLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIV
EEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNR
LRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
Ligand information
>6m62 Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<.....>>>>>.....<<<<...<<<<....>>>>..>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m62 Coupling of 5S RNP rotation with maturation of functional centers during large ribosomal subunit assembly.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K46 R49 E59 L66 R70 R77 H92 I93 A94 S95 F99 R146 R148 G149 L151 E170 T171 R275 S278 F280 R292 S302 A304
Binding residue
(residue number reindexed from 1)		K32 R35 E45 L52 R56 R63 H78 I79 A80 S81 F85 R111 R113 G114 L116 E135 T136 R240 S243 F245 R257 S267 A269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m62, PDBe:6m62, PDBj:6m62
PDBsum6m62
PubMed32719344
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]