Structure of PDB 5dat Chain o3 Binding Site BS03

Receptor Information

>5dat Chain o3 (length=106) Species: 559292 (Saccharomyces cerevisiae S288C)

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

Ligand information

• Ligand ID: OHX
• InChI: InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6
• InChIKey: OWCQTVJQFLTQTE-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: N[Os](N)(N)(N)(N)N
• Formula: H12 N6 Os
• Name: osmium (III) hexammine;
  osmium(6+) hexaazanide
• PDB chain: 5dat Chain o3 Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5dat Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): F85 R86
• Binding residue (residue number reindexed from 1): F84 R85
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5dat, PDBe:5dat, PDBj:5dat
• PDBsum: 5dat
• UniProt: P05744|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)