Structure of PDB 5t5h Chain o Binding Site BS03

Receptor Information
>5t5h Chain o (length=85) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRTVKMGVMGRYGARYGANPRKRAKKLEVSQHARHFCSFCGKFAFRRKAV
GIWRCDGCSKTMAGGAYTLSTPNNSTVRSTVRRLR
Ligand information
>5t5h Chain E (length=146) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaugcggccaggugaccaaucaauccucccacggugagcuuucuu
uucaccauaauccacuugggccuuucgaguuguucggaacgggggcucaa
gauugaaaaaugcaguugugaguucuauuaaagcaaaaaccugggg
<<......>>..<<<<<<............<<<.<<.<<<<<<.......
>>>>>>....<<.<<<<<<<<<<<<<<<.....>>>....>>>>>>>>>>
>.>.>>..........>>.>>>................>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		E30 Q33 H34 R36 F41 R49 K50 A51 V52 Y69
Binding residue
(residue number reindexed from 1)		E28 Q31 H32 R34 F39 R47 K48 A49 V50 Y67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum5t5h
PubMed27791004
UniProtQ4DAV9

[Back to BioLiP]