Structure of PDB 5t5h Chain n Binding Site BS03

Receptor Information

TKGTTSMGQRHGRTHILCRRCGRNAYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRMRYLKEVNRRIKNHFKTSL

Ligand information

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagauuaccgaaucuuugaacgcaa
acggcgcaugggagaaauccccgugcaugccauauuucucagugucg

.........................................<<<<<<.((
.....>>>......<<<<......))....>>>>.....>>>....<<..
...>><<<<<<<.<...>.>>>>>>>.....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution	2.54 Å
Binding residue (original residue number in PDB)	I17 R20 R21 C22 G23 Y39 A42 R44 T59 G60 T61 G62 R63 M64 R65 Y66 L67 R72 R73 I74 K75 N76 H77 K79 S81
Binding residue (residue number reindexed from 1)	I16 R19 R20 C21 G22 Y38 A41 R43 T58 G59 T60 G61 R62 M63 R64 Y65 L66 R71 R72 I73 K74 N75 H76 K78 S80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links