Structure of PDB 8rjb Chain l Binding Site BS03

Receptor Information
>8rjb Chain l (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>8rjb Chain v (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rjb UCSF ChimeraX: Meeting modern challenges in visualization and analysis.
Resolution2.69243 Å
Binding residue
(original residue number in PDB)		F7 K15 K18 Q19 R21 I23 P24 W26 M29 K30 T31 I35 K40
Binding residue
(residue number reindexed from 1)		F6 K14 K17 Q18 R20 I22 P23 W25 M28 K29 T30 I34 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rjb, PDBe:8rjb, PDBj:8rjb
PDBsum8rjb
PubMed38896445
UniProtG1TTN1

[Back to BioLiP]