Structure of PDB 5t2a Chain l Binding Site BS03

Receptor Information
>5t2a Chain l (length=81) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFKTPK
Ligand information
>5t2a Chain C (length=162) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaucauuaauugcccaaucuuu
gaacgcaaacggcgcaugggagaagcucgagccauccccgugcaugccac
aucucagugucg
.........................................<<<<<<.((
.....>>>.....<<<<<......))............>>>>.>...>>>
....<<.....>><<<<<<<....<<<..>>>....>>>>>>>.......
............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R20 R21 G23 A42 R44 T59 T61 G62 R63 C64 Y66 R72 R73 N76 H77 K79 T80 P81
Binding residue
(residue number reindexed from 1)
R19 R20 G22 A41 R43 T58 T60 G61 R62 C63 Y65 R71 R72 N75 H76 K78 T79 P80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
PDBsum5t2a
PubMed27752045
UniProtP62885|RL37_LEIDO Large ribosomal subunit protein eL37 (Gene Name=RPL37)

[Back to BioLiP]