Structure of PDB 3jcs Chain l Binding Site BS03

Receptor Information
>3jcs Chain l (length=50) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRFKPLAVKKKYAKKMNQNKPVPYWIRLRTGNRIKWNEKRRHWRRTKLNY
Ligand information
>3jcs Chain 7 (length=154) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauucguugaagaacgcagua
aagugcgauaagugguaucaauugcagaaauuaccaaucuuugaacgcaa
acggcgcaugggagaagcuugucauccccgugcaugccauauucucagug
ucga
........................................<<<<<<<((.
...>>>>.....<<<<<......))......>>>>>...>>>....<<..
...>><<<<<<<.<(.<<..>>>.).>>>>>>>.................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L7 K12 K15 N18 Q19 V23 W26 L29 R30 T31 I35 N38
Binding residue
(residue number reindexed from 1)		L6 K11 K14 N17 Q18 V22 W25 L28 R29 T30 I34 N37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
PDBsum3jcs
PubMed27373148
UniProtE9BCX6

[Back to BioLiP]