Structure of PDB 5lzs Chain jj Binding Site BS03

Receptor Information
>5lzs Chain jj (length=441) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGS
FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMI
TGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVN
KMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLE
PSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDV
YKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEAL
PGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQI
SAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVD
MVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK
Ligand information
>5lzs Chain ii (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuccguaguguagcgguuaucacguucgccuaacacgcgaaagguccu
cgguucgaaaccgggcggaaacacca
<<.<<<<..<<<<.......>>.>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>.>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lzs Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		I73 F98 K100 N101 Y254 I256 V262 E293 H295 H296 G309 G351 Y357 A358 V360 K408 M429 R430
Binding residue
(residue number reindexed from 1)		I70 F95 K97 N98 Y251 I253 V259 E290 H292 H293 G306 G348 Y354 A355 V357 K405 M426 R427
Enzymatic activity
Enzyme Commision number 3.6.5.-
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0019900 kinase binding
GO:0019901 protein kinase binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0044829 positive regulation by host of viral genome replication
GO:0071364 cellular response to epidermal growth factor stimulus
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022626 cytosolic ribosome
GO:0030864 cortical actin cytoskeleton
GO:0032587 ruffle membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lzs, PDBe:5lzs, PDBj:5lzs
PDBsum5lzs
PubMed27863242
UniProtP68105|EF1A1_RABIT Elongation factor 1-alpha 1 (Gene Name=EEF1A1)

[Back to BioLiP]