Structure of PDB 5t5h Chain j Binding Site BS03

Receptor Information
>5t5h Chain j (length=104) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRVQYRRRMHYATRGNRMKLVRTPGNRLVMQKRVKRSQGPHTPWVLGHKR
LAGTKALRHTEARLASRHEKSTSRPYGGVLSHEQVRDRIVRAFLIEEQRI
VKRA
Ligand information
>5t5h Chain E (length=146) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaugcggccaggugaccaaucaauccucccacggugagcuuucuu
uucaccauaauccacuugggccuuucgaguuguucggaacgggggcucaa
gauugaaaaaugcaguugugaguucuauuaaagcaaaaaccugggg
<<......>>..<<<<<<............<<<.<<.<<<<<<.......
>>>>>>....<<.<<<<<<<<<<<<<<<.....>>>....>>>>>>>>>>
>.>.>>..........>>.>>>................>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R17 L23 R25 T26 P27 G28 N29 L31 R36 K38 R39 S40 Q41 G42 P43 H44 P46 W47 H51 A55 G56 T57 A59 H62 R66 R70 H71 K73 T75 S76 R77 Y79 G81 V82 H85
Binding residue
(residue number reindexed from 1)		R14 L20 R22 T23 P24 G25 N26 L28 R33 K35 R36 S37 Q38 G39 P40 H41 P43 W44 H48 A52 G53 T54 A56 H59 R63 R67 H68 K70 T72 S73 R74 Y76 G78 V79 H82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum5t5h
PubMed27791004
UniProtQ4DB26

[Back to BioLiP]