Structure of PDB 3j81 Chain j Binding Site BS03

Receptor Information
>3j81 Chain j (length=252) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELS
RRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKY
QKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDE
TVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSA
EDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCN
IT
Ligand information
>3j81 Chain 3 (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucucucucuaugcucucucuc
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R55 R57
Binding residue
(residue number reindexed from 1)		R53 R55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0043022 ribosome binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0010494 cytoplasmic stress granule
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j81, PDBe:3j81, PDBj:3j81
PDBsum3j81
PubMed25417110
UniProtP20459|IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha (Gene Name=SUI2)

[Back to BioLiP]