Structure of PDB 7pkt Chain i Binding Site BS03

Receptor Information

>7pkt Chain i (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EAIKHLKDLQHIKLEGLRFRIIDAKGQVVGRLAEQISVILQGKDKPTYNP
TKEQGDVVIVVNASHVELTHDKWNTKLYRWHTGYPGGLRSRPAGDQWEKD
PRMLLRNAVSGMLPKNKSREARMEKLKIFPEADHPFQGFPLVPYVPPPRR
LQ

Ligand information

>7pkt Chain 5 (length=149) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagguagagucugcguugaacaccagaacauaggcuuggaagcagccacu
gugcuuggaaagcguaauagcucacuggucuagcagucuccgcuuauaua
uguccggcacuauugccgaagcccgccuaugacaaauuuuuuuuuuuuu

<<..<.<<<.<<<........<<<<<.<<...<<<<.......>>>>...
>>........<<<......>>>..>>>>>....>>>.>>>.>.>>.....
.................................................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	V33 G35 R36 T74 H75 K77 K81 R84 H86 G91 A113 G116
Binding residue (residue number reindexed from 1)	V28 G30 R31 T69 H70 K72 K76 R79 H81 G86 A108 G111

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum	7pkt
PubMed	34887394
UniProt	A8J810

[Back to BioLiP]