Structure of PDB 5gah Chain i Binding Site BS03

Receptor Information
>5gah Chain i (length=126) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFDLNDFLEQLRQMKNMGGPPPPPPPPPPPPPPPPPPPPPPDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
KKMKKGGPPPPPPPPPPPPPPPPPPP
Ligand information
>5gah Chain k (length=18) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MKQSTLALLLLLLLLTPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gah Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q337 M341 X350 X365 X366 Q419 M423 X439
Binding residue
(residue number reindexed from 1)		Q10 M14 X23 X38 X39 Q92 M96 X112
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008312 7S RNA binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0006612 protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0048500 signal recognition particle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gah, PDBe:5gah, PDBj:5gah
PDBsum5gah
PubMed26804923
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]