Structure of PDB 5gag Chain i Binding Site BS03

Receptor Information

>5gag Chain i (length=126) Species: 562 (Escherichia coli)

GFDLNDFLEQLRQMKNMGGPPPPPPPPPPPPPPPPPPPPPPDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
KKMKKGGPPPPPPPPPPPPPPPPPPP

Ligand information

>5gag Chain k (length=18) Species: 562 (Escherichia coli)

MKQSTLALLLLLLLLTPV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gag Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): Q337 M341 X350 X354 X365 X366 D369 Q419 M423 M430 X435
• Binding residue (residue number reindexed from 1): Q10 M14 X23 X27 X38 X39 D42 Q92 M96 M103 X108

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0008312 7S RNA binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0048500 signal recognition particle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5gag, PDBe:5gag, PDBj:5gag
• PDBsum: 5gag
• PubMed: 26804923
• UniProt: P0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)