Structure of PDB 5t2a Chain h Binding Site BS03

Receptor Information

>5t2a Chain h (length=124) Species: 5661 (Leishmania donovani)

SCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGH
KRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQ
RIVKQALKEHSKMKLSHKRTANKK

Ligand information

>5t2a Chain E (length=169)

gugguaaugcgcacuugccagguaacaaaucaauccucccacggugagcu
uucuuuucaccauaauccacuugggccuuuuuacgcguuguucggagcgg
gggcucaagauugaaaaaugcagcucguacugugugaguucugcgcauua
aagcaaaaaccuggggugu

<<<....>>>..<<<..<<<<<<.......<<...<<<....<<<<<<..
.....>>>>>><...<<.<<<<<<<<<<<<...<<.......>>....>>
>>>>>>>>>.>.>>....><<<<......>>>>..>>>...>>.......
........>>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): C3 R17 R20 M23 R25 P27 N29 R36 K38 R39 S40 Q41 G42 H44 P46 W47 H51 R53 G55 G56 A59 H62 R66 H71 K73 V75 S76 R77 Y79 G81 H85
• Binding residue (residue number reindexed from 1): C2 R16 R19 M22 R24 P26 N28 R35 K37 R38 S39 Q40 G41 H43 P45 W46 H50 R52 G54 G55 A58 H61 R65 H70 K72 V74 S75 R76 Y78 G80 H84

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
• PDBsum: 5t2a
• PubMed: 27752045
• UniProt: A0A3Q8IHK2