Structure of PDB 3jcs Chain h Binding Site BS03

Receptor Information

>3jcs Chain h (length=108) Species: 5661 (Leishmania donovani)

SCPRVQYRRRMHYATRGNRMMVRTPGNKLVMQKRAKRSQGIHTPWVLGHK
RLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQR
IVKQALKE

Ligand information

>3jcs Chain 3 (length=184)

gugguaaugcgauugccagguaacaaaucaauccucccacggugagcuuu
cuuucaccauaauccaucuccggcuuugcuggggcuugggccuuuuuacu
ucucgcguuguucgggggcucaagauugaaaaaugcagcucucguacugu
uuguugugaguucuauuaaagcaaaaaccugggg

<<<....>>>.....<<<<<<....<...<.<<.<..<<.<<<<<<....
..>>>>>><...<<.<...<............>.<<<<<<<<<<<.....
.<.......>...>>>>>>>>>>>.>.>>....>...<........>...
.>>..>.>.>>....>..........>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): C3 R20 M23 R25 P27 N29 L31 R36 K38 S40 Q41 G42 H44 T45 P46 W47 H51 G55 G56 K58 H62 A65 R66 R70 H71 K73 S74 V75 S76 R77 G80 G81 H85
• Binding residue (residue number reindexed from 1): C2 R19 M21 R23 P25 N27 L29 R34 K36 S38 Q39 G40 H42 T43 P44 W45 H49 G53 G54 K56 H60 A63 R64 R68 H69 K71 S72 V73 S74 R75 G78 G79 H83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
• PDBsum: 3jcs
• PubMed: 27373148
• UniProt: A0A3Q8IHK2