Structure of PDB 5imq Chain d Binding Site BS03

Receptor Information

>5imq Chain d (length=182) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDA
RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMW
IFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVD
ALRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>5imq Chain E (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<...<.<.<<<<<<<<....>>>>>>>>
...>.>.>>>.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Resolution	3.8 Å
Binding residue (original residue number in PDB)	Q26 W29 E30 G65 Q66 G89 V92 T93 L94 R95 R96 R98
Binding residue (residue number reindexed from 1)	Q26 W29 E30 G65 Q66 G89 V92 T93 L94 R95 R96 R98

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum	5imq
PubMed	27137929
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]