Structure of PDB 2wqj Chain Z Binding Site BS03

Receptor Information
>2wqj Chain Z (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTYYLQVRGRENFEILMKLKESLELMELVPQ
Ligand information
>2wqj Chain Y (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDTYYLQVRGRENFEILMKLKESLEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wqj Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D353 T354 Y355 Y356 L357 Q358 V359 G361 R362 F365 L368 K372 L375 E379
Binding residue
(residue number reindexed from 1)		D1 T2 Y3 Y4 L5 Q6 V7 G9 R10 F13 L16 K20 L23 E27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wqj, PDBe:2wqj, PDBj:2wqj
PDBsum2wqj
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]