Structure of PDB 7nbu Chain Y Binding Site BS03

Receptor Information
>7nbu Chain Y (length=121) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGS
IKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYANQQKTPKTKIE
TALDRQKIWKRAFGDTPPILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nbu Substrate recognition and cryo-EM structure of the ribosome-bound TAC toxin of Mycobacterium tuberculosis.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		K58 R68 N73 Q98 K99
Binding residue
(residue number reindexed from 1)		K52 R62 N67 Q92 K93
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0001666 response to hypoxia
GO:0045926 negative regulation of growth
GO:0098754 detoxification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7nbu, PDBe:7nbu, PDBj:7nbu
PDBsum7nbu
PubMed35552387
UniProtP9WJA5|HIGB1_MYCTU Probable endoribonuclease HigB1 (Gene Name=higB1)

[Back to BioLiP]