Structure of PDB 5yzg Chain Y Binding Site BS03

Receptor Information
>5yzg Chain Y (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIY
KGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTME
HGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVL
ENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEE
ARKR
Ligand information
>5yzg Chain H (length=139) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuuua
auauguccucuaccgaggacaauauuaaggauuuuuggagcagggagcca
cgcaucgaccugguauugcaguaccuccaggaacggugc
...............................................<<<
<<<<<<<<<<....>>>>>>.>>>>>>>...............<......
><<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yzg Structure of a human catalytic step I spliceosome
Resolution4.1 Å
Binding residue
(original residue number in PDB)
R4 K9 K22 K24
Binding residue
(residue number reindexed from 1)
R3 K8 K21 K23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5yzg, PDBe:5yzg, PDBj:5yzg
PDBsum5yzg
PubMed29301961
UniProtQ9BW85|YJU2_HUMAN Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]